Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12134-2-AP targets UBE2C in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2780 Product name: Recombinant human UBE2C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC016292 Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP Predict reactive species |
| Full Name | ubiquitin-conjugating enzyme E2C |
| Calculated Molecular Weight | 179 aa, 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC016292 |
| Gene Symbol | UBE2C |
| Gene ID (NCBI) | 11065 |
| RRID | AB_2212191 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00762 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UBE2C(Ubiquitin-conjugating enzyme E2 C) is also known as UBCH10 and belongs to the ubiquitin-conjugating enzyme family. It is highly expressed in a variety of human primary tumors, and it is able to promote cell proliferation and malignant transformation (PMID:18703417). UBE2C, along with the E3 ligase of the anaphasepromoting complex (APC), catalyzes the ubiquitination of mitotic cyclins A and B, as well as securin. UBE2C is essential for cell cycle progression, and mutation of its active site cysteine confers a dominant-negative phenotype(PMID:17217624).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBE2C antibody 12134-2-AP | Download protocol |
| IP protocol for UBE2C antibody 12134-2-AP | Download protocol |
| WB protocol for UBE2C antibody 12134-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-UBE2C antibody (Cat# 12134-2-AP) has 25 citations spanning journals including Plant Cell, Cancer Letters, Arteriosclerosis, Thrombosis and Vascular Biology, International Journal of Biological Macromolecules, Atherosclerosis, Biochemical Pharmacology, Cell & Bioscience, Journal of Biological Chemistry, PLoS Genetics, and Endocrinology. Research fields cover oncology (hepatocellular, thyroid, prostate, bladder, colorectal, lung, endometrial, esophageal, and squamous cell carcinomas), cardiovascular disease, neurodevelopment, plant biology, immunology, and osteoarthritis.
| Species | Application | Title |
|---|---|---|
Plant Cell SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling. | ||
Cancer Lett UBE2C Mediates Follicular Thyroid Carcinoma Invasion and Metastasis via K29-Specific Vimentin Ubiquitination
| ||
Arterioscler Thromb Vasc Biol Disturbed Flow Increases UBE2C (Ubiquitin E2 Ligase C) via Loss of miR-483-3p, Inducing Aortic Valve Calcification by the pVHL (von Hippel-Lindau Protein) and HIF-1α (Hypoxia-Inducible Factor-1α) Pathway in Endothelial Cells. | ||
Int J Biol Macromol UBE2C regulates the KEAP1/NRF2 signaling pathway to promote the growth of gastric cancer by inhibiting autophagy
| ||
Int J Biol Macromol Longitudinal single-cell RNA sequencing reveals a heterogeneous response of plasma cells to colonic inflammation | ||
Atherosclerosis Cell surface nucleolin promotes endothelial cell pyroptosis in atherosclerosis through RASSF2. |
