UBE2C Monoclonal antibody, PBS Only

• 

  WB analysis using 66087-1-Ig (same clone as 66087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66087-1-Ig (UBE2C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66087-1-Ig (UBE2C antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66087-1-Ig (same clone as 66087-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using UBE2C antibody (66087-1-Ig, Clone: 1C12H8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66087-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UBE2C Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66087-1-PBS

Clone No.1C12H8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

(E3-independent) E2 ubiquitin-conjugating enzyme C, 1C12H8, E2 ubiquitin-conjugating enzyme C, EC:2.3.2.23, EC:2.3.2.24

---

Product Information

66087-1-PBS targets UBE2C in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19235

  Product name: Recombinant human UBE2C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-179 aa of BC016292

  Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

• Full Name: ubiquitin-conjugating enzyme E2C
• Calculated Molecular Weight: 179 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC016292
• Gene Symbol: UBE2C
• Gene ID (NCBI): 11065
• RRID: AB_11232220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00762
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBE2C(Ubiquitin-conjugating enzyme E2 C) is also known as UBCH10 and belongs to the ubiquitin-conjugating enzyme family. It is highly expressed in a variety of human primary tumors, and it is able to promote cell proliferation and malignant transformation(PMID:18703417). UBE2C, along with the E3 ligase of the anaphasepromoting complex (APC), catalyzes the ubiquitination of mitotic cyclins A and B, as well as securin. UBE2C is essential for cell cycle progression, and mutation of its active site cysteine confers a dominant-negative phenotype(PMID:17217624).