UBE2D1/2/3/4 Monoclonal antibody, PBS Only

UBE2D1/2/3/4 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68138-1-PBS
Clone No.1C7D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

UBE2D3, (E3-independent) E2 ubiquitin-conjugating enzyme D3, E2 ubiquitin-conjugating enzyme D3, E2(17)KB3, EC:2.3.2.23

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68138-1-PBS targets UBE2D1/2/3/4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2278

Product name: Recombinant human UBE2D3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC003395

Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight17 kDa
GenBank Accession NumberBC003395
Gene Symbol UBE2D3
Gene ID (NCBI) 7323
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61077
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Loading...
||
New chat Able
正在加载,请稍候...