UBE2F Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBE2F Polyclonal antibody, PBS Only (17056-1-PBS)

• 

  WB analysis using 17056-1-AP (same clone as 17056-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17056-1-AP (UBE2F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17056-1-AP (same clone as 17056-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17056-1-AP (UBE2F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 17056-1-AP (same clone as 17056-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 17056-1-AP (UBE2F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17056-1-AP (same clone as 17056-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17056-1-AP (UBE2F antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17056-1-AP (same clone as 17056-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17056-1-AP (UBE2F antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 17056-1-AP (same clone as 17056-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using 17056-1-AP (UBE2F antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17056-1-PBS in a different storage buffer formulation.

UBE2F Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17056-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17056-1-PBS targets UBE2F in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10764

  Product name: Recombinant human UBE2F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC010549

  Sequence: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

• Full Name: ubiquitin-conjugating enzyme E2F (putative)
• Calculated Molecular Weight: 185 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC010549
• Gene Symbol: UBE2F
• Gene ID (NCBI): 140739
• RRID: AB_2210295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969M7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBE2F(Ubiquitin-conjugating enzyme E2 F) is also named as NCE2(NEDD8-conjugating enzyme 2) and belongs to the ubiquitin-conjugating enzyme family.The canonical uBE2M catalyses the modification of most cullins, whereas uBE2F is specifically responsible for cuL5 neddylation. uBE2F is regulated differently than uBE2M, supporting the idea that neddylation is used to fine-tune ubiquitin-chain formation by different cullin-dependent E3s(PMID:19465892).