UBE2J1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBE2J1 Polyclonal antibody (27890-1-AP)

• 

  WB analysis using 27890-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27890-1-AP (UBE2J1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

UBE2J1 Polyclonal Antibody for WB, ELISA

Cat No. 27890-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CGI 76, HSPC153, HSPC205, HSU93243, HsUBC6e

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27890-1-AP targets UBE2J1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27310

  Product name: Recombinant human UBE2J1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-283 aa of BC013973

  Sequence: PTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD

• Full Name: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
• Calculated Molecular Weight: 318 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC013973
• Gene Symbol: UBE2J1
• Gene ID (NCBI): 51465
• RRID: AB_3742264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y385
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin-conjugating enzyme E2 J1 (UBE2J1) has been proven to participate in the ubiquitination of multiple substrate proteins. Belonged to the ubiquitin-conjugating E2 enzyme family, the ubiquitin-conjugating enzyme E2 J1 (UBE2J1) is anchored in the endoplasmic reticulum (ER) membrane and contains a luminal domain, a single transmembrane region, and a cytoplasmic catalytic domain. (PMID: 36567344, PMID: 38030789)