UBC13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBC13 Polyclonal antibody (10243-1-AP)

UBC13 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10243-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IP, CoIP, ChIP, RIP, ELISA

Synonyms

UBE2N, UbcH13, UbcH ben, EC:2.3.2.23, E2 ubiquitin-conjugating enzyme N

• 

  WB analysis of mouse thymus using 10243-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10243-1-AP (UBC13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10243-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10243-1-AP (UBC13 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 10243-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10243-1-AP (UBC13 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 10243-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 10243-1-AP (UBC13 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse small intestine using 10243-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 10243-1-AP (UBC13 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 10243-1-AP

  IP result of anti-UBC13 (IP:10243-1-AP, 4ug; Detection:10243-1-AP 1:600) with MCF-7 cells lysate 1280ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10243-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10243-1-AP (UBC13 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10243-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10243-1-AP (UBC13 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10243-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10243-1-AP (UBC13 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, human heart tissue, Jurkat cells, mouse small intestine tissue
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human colon tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10243-1-AP targets UBC13 in WB, IHC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0292

  Product name: Recombinant human UBE2N protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC000396

  Sequence: MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYA

• Full Name: ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC000396
• Gene Symbol: UBC13/UBE2N
• Gene ID (NCBI): 7334
• RRID: AB_2288109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61088
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2N is a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	WB	Alzheimers Dement; Suppressing UBE2N ameliorates Alzheimer's disease pathology through the clearance of amyloid beta; Authors - Chen Zhang
mouse	WB	Cell Mol Immunol; The deubiquitinase OTUB1 augments NF-κB-dependent immune responses in dendritic cells in infection and inflammation by stabilizing UBC13.; Authors - Floriana Mulas
pig	WB	Mol Cell Proteomics; The mechano-ubiquitinome of articular cartilage: Differential ubiquitination and activation of a group of ER-associated DUBs and ER stress regulators; Authors - Nitchakarn Kaokhum
human	RIP	Cell Signal; MIR4435-2HG promotes breast cancer evolution through miR-205-5p/UBE2N axis and exosome-mediated macrophage M2-like polarization.; Authors - Rui Zhang
human	WB	Cancer Gene Ther; UBE2N inhibition abrogates cancer chemoresistance and metastasis in lung adenocarcinoma; Authors - Zi-Mei Peng
mouse	WB,CoIP	Hum Mutat; Experimental Validation and Bioinformatics Analysis Elucidate the Role of MTDH-Mediated PTEN Ubiquitination and Degradation in Podocyte Injury in Diabetic Kidney Disease.; Authors - Zerong Zheng ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Jessica (Verified Customer) (11-14-2019)

Antibody works well for detecting the endogenous Ubc13 protein in 293T cells. Strong signal and few non specific bands.

• Applications: Western Blot,
• Cell Tissue Type: 293T cells