MMS2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 10689-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 10689-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10689-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10689-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10689-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 10689-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10689-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10689-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10689-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 10689-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 10689-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 10689-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 10689-1-AP (MMS2 antibody at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 10689-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 10689-1-AP (MMS2 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 10689-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10689-1-AP (MMS2 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 10689-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10689-1-AP (MMS2 antibody at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 10689-1-AP

  Immunofluorescent analysis of HeLa cells using 10689-1-AP (MMS2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 10689-1-AP

  Immunofluorescent analysis of HEK-293 cells using 10689-1-AP (MMS2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

MMS2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10689-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UBE2V2, DDVit 1, DDVIT1, EDAF 1, EDAF-1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A375 cells, HeLa cells, HL-60 cells, human brain tissue, Jurkat cells, K-562 cells, rat liver tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

10689-1-AP targets MMS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1111

  Product name: Recombinant human UBE2V2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC007051

  Sequence: MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Full Name: ubiquitin-conjugating enzyme E2 variant 2
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC007051
• Gene Symbol: MMS2
• Gene ID (NCBI): 7336
• RRID: AB_2211656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15819
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMS2 encodes a 137-amino acid, 15.2-kDa protein with significant sequence homology to a conserved family of ubiquitin-conjugating (Ubc) proteins (PMID: 9576943). Mms2 is a ubiquitin E2-variant protein with a very well-documented function in the tolerance pathway that protects both human and yeast cells from the lethal and mutagenic effects of DNA damage (PMID: 36934633). A high expression level of human MMS2 is associated with poor survival prognosis in different cancer diseases (PMID: 36934633).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Transl Stroke Res; MicroRNA-193a-5p Rescues Ischemic Cerebral Injury by Restoring N2-Like Neutrophil Subsets; Authors - Ziping Han
human	WB,IF	Biochim Biophys Acta; Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.; Authors - Fan Chai