UBE3A Monoclonal antibody, PBS Only (Capture)

UBE3A Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 60038-1-PBS
Clone No.3D6H9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA, Sample test

3D6H9, ANCR, AS, E6 AP, E6AP

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60038-1-PBS targets UBE3A as part of a matched antibody pair:

MP51408-1: 60038-1-PBS capture and 60977-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0346

Product name: Recombinant human UBE3A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 9-215 aa of BC002582

Sequence: GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS

Predict reactive species
Full Name ubiquitin protein ligase E3A
Calculated Molecular Weight 852 aa, 98 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC002582
Gene Symbol UBE3A
Gene ID (NCBI) 7337
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ05086
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

UBE3A(Ubiquitin-protein ligase E3A) is also named as E6AP, EPVE6AP, HPVE6A and belongs to the E3 ubiquitin protein ligase family. It functions as both an E3 ligase in the ubiquitin proteasome pathway and as a transcriptional coactivator. It is also initially identified as a cellular protein that mediates in vitro association of the human papillomavirus E6 protein with p53, leading to the ubiquitin-dependent degradation of p53(PMID:1661671). Defects in UBE3A are a cause of Angelman syndrome (AS)(PMID:10508479 ). It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat

Able

正在加载,请稍候...