UBL4A Polyclonal antibody

• 

  WB analysis of HeLa using 14253-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 14253-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 14253-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14253-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 14253-1-AP

  IP result of anti-UBL4A (IP:14253-1-AP, 4ug; Detection:14253-1-AP 1:500) with mouse testis tissue lysate 4400ug.

• 

  IHC staining of human ovary tumor using 14253-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14253-1-AP (UBL4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary tumor using 14253-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14253-1-AP (UBL4A antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 14253-1-AP

  Immunofluorescent analysis of HepG2 cells, using UBL4A antibody 14253-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

UBL4A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14253-1-AP

Publications(13)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Ubiquitin-like protein 4A, ubiquitin like 4A, GDX, G6PD, DXS254E

---

Tested Applications

• Positive WB detected in: HeLa cells, HUVEC cells, mouse testis tissue, human brain tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 13 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

14253-1-AP targets UBL4A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5526

  Product name: Recombinant human UBL4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC043346

  Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

• Full Name: ubiquitin-like 4A
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC043346
• Gene Symbol: UBL4A
• Gene ID (NCBI): 8266
• RRID: AB_2288205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11441
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Invest; Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer; Authors - Xiaochao Tan
mouse	WB,IF	J Immunol; UBL4A Augments Innate Immunity by Promoting the K63-Linked Ubiquitination of TRAF6.; Authors - Shu-Jie Peng ; KD Validated
human	WB	J Virol; SGTA-dependent regulation of Hsc70 promotes cytosol entry of SV40 from the ER.; Authors - Allison Dupzyk
pig	WB	J Nutr; Intermittent Bolus Compared With Continuous Feeding Enhances Insulin and Amino Acid Signaling to Translation Initiation in Skeletal Muscle of Neonatal Pigs.; Authors - Agus Suryawan
human	WB	J Inherit Metab Dis; Mutations in GET4 disrupt the transmembrane domain recognition complex pathway.; Authors - Mitali A Tambe
pig	WB	Pediatr Res; Preterm birth alters the feeding-induced activation of Akt signaling in the muscle of neonatal piglets; Authors - Agus Suryawan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

WEI (Verified Customer) (03-08-2022)

Weak specific band around the target size

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse Heart

FH

WEI (Verified Customer) (10-21-2020)

This antibody recognizes a sharp, clear band around 16kDa from mouse hearts.

• Applications: Western Blot
• Cell Tissue Type: Mouse Heart

FH

Tom (Verified Customer) (10-09-2020)

This antibody specifically recognizes mouse UBL4A protein. The band was approximately 17kD.

• Applications: Western Blot