UBL4A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBL4A Polyclonal antibody (14253-1-AP)

• Featured Product
• KD/KO Validated

UBL4A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14253-1-AP Copied!

Publications (16)

Reviews (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Ubiquitin-like protein 4A, ubiquitin like 4A, GDX, G6PD, DXS254E

• 

  WB analysis of HeLa using 14253-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HUVEC using 14253-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 14253-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14253-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14253-1-AP (UBL4A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 14253-1-AP

  IP result of anti-UBL4A (IP:14253-1-AP, 4ug; Detection:14253-1-AP 1:500) with mouse testis tissue lysate 4400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14253-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14253-1-AP (UBL4A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14253-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14253-1-AP (UBL4A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14253-1-AP

  Immunofluorescent analysis of HepG2 cells, using UBL4A antibody 14253-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UBL4A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HUVEC cells, mouse testis tissue, human brain tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14253-1-AP targets UBL4A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5526

  Product name: Recombinant human UBL4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC043346

  Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

• Full Name: ubiquitin-like 4A
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC043346
• Gene Symbol: UBL4A
• Gene ID (NCBI): 8266
• RRID: AB_2288205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11441
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UBL4A Polyclonal antibody (Cat# 14253-1-AP) has 16 citations spanning journals including Nature Communications, JCI, J Exp Clin Cancer Res, EMBO Reports, Acta Pharmacol Sinica, J Immunol, J Virol, Biochem J, and others. Research fields cover cancer (pancreatic, breast, melanoma), autophagy, atherosclerosis, protein quality control, innate immunity, viral infection, neonatal nutrition, and intracerebral hemorrhage. Applications cited include WB, IF, IHC, IP, and CoIP across human, mouse, rat, and pig species.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Supercharging-enhanced nDIA-MS enables global profiling of drug-induced proteome solubility shifts.; Authors - Yun Xiong
human	WB	J Clin Invest; Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer; Authors - Xiaochao Tan
human	WB,IF,IP	J Exp Clin Cancer Res; UBL4A inhibits autophagy-mediated proliferation and metastasis of pancreatic ductal adenocarcinoma via targeting LAMP1.; Authors - Hongze Chen ; KD Validated
human	WB	Acta Pharmacol Sin; SEC62-dependent ER-phagy contributes to apelin-13/APJ-induced monocyte-vascular endothelial cell adhesion in atherosclerosis pathogenesis; Authors - Zhe Chen
human	WB	EMBO Rep; C9orf72 protein quality control by UBR5-mediated heterotypic ubiquitin chains; Authors - Julia Jülg
human	WB,IHC	Cancer Biol Ther; GdX inhibits the occurrence and progression of breast cancer by negatively modulating the activity of STAT3; Authors - Zhilin Chen

Reviews

4.6 out of 5

3 verified customer reviews

What customers say

All three reviews are for Western Blot applications using lot 00005321, with ratings of 4–5 out of 5. Users report that the antibody produces a specific band at approximately 16–17 kDa, consistent with the expected UBL4A molecular weight. One reviewer noted the band was somewhat weak but specific, while another described it as sharp and clear in mouse heart tissue. Overall, reviewers found the antibody to be specific for mouse UBL4A with good performance in WB.

Automatically generated from the 3 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

WEI (Verified Customer) (03-08-2022)

Weak specific band around the target size

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse Heart

WEI (Verified Customer) (10-21-2020)

This antibody recognizes a sharp, clear band around 16kDa from mouse hearts.

• Applications: Western Blot
• Cell Tissue Type: Mouse Heart

Tom (Verified Customer) (10-09-2020)

This antibody specifically recognizes mouse UBL4A protein. The band was approximately 17kD.

• Applications: Western Blot