UBL5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBL5 Polyclonal antibody, PBS Only (10715-1-PBS)

• 

  IHC staining of mouse heart using 10715-1-AP (same clone as 10715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10715-1-AP (UBL5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10715-1-PBS in a different storage buffer formulation.

UBL5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10715-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

HUB1, ubiquitin like 5, Ubiquitin like protein 5, Ubiquitin-like protein 5

---

Product Information

10715-1-PBS targets UBL5 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1122

  Product name: Recombinant human UBL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC007053

  Sequence: MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

• Full Name: ubiquitin-like 5
• Calculated Molecular Weight: 8.5 kDa
• GenBank Accession Number: BC007053
• Gene Symbol: UBL5
• Gene ID (NCBI): 59286
• RRID: AB_2163941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZL1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.