BMSC UbP Polyclonal antibody

BMSC UbP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11564-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Ubiquitin-like protein SB132, Ubiquitin-like protein 7, SB132, Bone marrow stromal cell ubiquitin-like protein, BMSC-UbP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, HeLa cells, HepG2 cells, Jurkat cells, rat testis tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11564-1-AP targets BMSC UbP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2130

Product name: Recombinant human UBL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-380 aa of BC030055

Sequence: MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP

Predict reactive species
Full Name ubiquitin-like 7 (bone marrow stromal cell-derived)
Calculated Molecular Weight 380 aa, 41 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC030055
Gene Symbol UBL7
Gene ID (NCBI) 84993
RRIDAB_2212080
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96S82
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin is an important cellular signal that targets proteins for degradation or regulates their functions. UBL7 (ORF name SB132) encodes ubiquitin-like protein7 also named bone marrow stromal cell ubiquitin-like protein (BMSC-UbP) capable of binding ubiquitin. BMSC-UbP protein is derived from bone marrow stromal cells containing a ubiquitin-associated (UBA) domain at the C terminus that has been implicated in linking cellular processes and the ubiquitin system. BMSC-UbP mRNA is widely expressed in human multiple tissues and various tumor cell lines and is decreased in BMSC stimulated with phorbol myristate acetate (PMA) suggesting a role in regulation of BMSC function.

Protocols

Product Specific Protocols
IF protocol for BMSC UbP antibody 11564-1-APDownload protocol
IHC protocol for BMSC UbP antibody 11564-1-APDownload protocol
IP protocol for BMSC UbP antibody 11564-1-APDownload protocol
WB protocol for BMSC UbP antibody 11564-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...