BMSC UbP Polyclonal antibody

• 

  WB analysis of mouse testis using 11564-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11564-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11564-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11564-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 11564-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11564-1-AP

  IP result of anti-BMSC UbP (IP:11564-1-AP, 4ug; Detection:11564-1-AP 1:1000) with HeLa cells lysate 2000ug.

• 

  IHC staining of human gliomas using 11564-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11564-1-AP (BMSC UbP antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 11564-1-AP

  Immunofluorescent analysis of HepG2 cells using 11564-1-AP (BMSC UbP antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

BMSC UbP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11564-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Ubiquitin-like protein SB132, Ubiquitin-like protein 7, SB132, Bone marrow stromal cell ubiquitin-like protein, BMSC-UbP

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HeLa cells, HepG2 cells, Jurkat cells, rat testis tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11564-1-AP targets BMSC UbP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2130

  Product name: Recombinant human UBL7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-380 aa of BC030055

  Sequence: MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP

• Full Name: ubiquitin-like 7 (bone marrow stromal cell-derived)
• Calculated Molecular Weight: 380 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC030055
• Gene Symbol: UBL7
• Gene ID (NCBI): 84993
• RRID: AB_2212080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S82
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin is an important cellular signal that targets proteins for degradation or regulates their functions. UBL7 (ORF name SB132) encodes ubiquitin-like protein7 also named bone marrow stromal cell ubiquitin-like protein (BMSC-UbP) capable of binding ubiquitin. BMSC-UbP protein is derived from bone marrow stromal cells containing a ubiquitin-associated (UBA) domain at the C terminus that has been implicated in linking cellular processes and the ubiquitin system. BMSC-UbP mRNA is widely expressed in human multiple tissues and various tumor cell lines and is decreased in BMSC stimulated with phorbol myristate acetate (PMA) suggesting a role in regulation of BMSC function.