UBTD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBTD1 Polyclonal antibody (20158-1-AP)

• 

  WB analysis using 20158-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20158-1-AP (UBTD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

UBTD1 Polyclonal Antibody for WB, ELISA

Cat No. 20158-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

ubiquitin domain containing 1

---

Tested Applications

• Positive WB detected in: DU 145 cells, MG-63 cells, U2OS cells, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20158-1-AP targets UBTD1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14082

  Product name: Recombinant human UBTD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-227 aa of BC007331

  Sequence: YCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

• Full Name: ubiquitin domain containing 1
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC007331
• Gene Symbol: UBTD1
• Gene ID (NCBI): 80019
• RRID: AB_3741979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAC8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin domain-containing protein 1 (UBTD1) is highly evolutionary conserved and has been described to interact with E2 enzymes of the ubiquitin-proteasome system. Even if its biological functions remain largely unknown, UBTD1 expression is regulated by P53 and induces cellular senescence by stabilizing P53 through degradation of murine double minute 2 (MDM2).(PMID: 30804013,PMID: 33884955)