UBTD2 Polyclonal antibody

• 

  WB analysis of human liver using 13172-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13172-1-AP (UBTD2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 13172-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13172-1-AP (UBTD2 antibody) at dilution of 1:100 (under 10x lens).

UBTD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13172-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DCUBP, DC-UbP, ubiquitin domain containing 2, Ubiquitin like protein SB72, UBTD2

---

Tested Applications

• Positive WB detected in: human liver tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13172-1-AP targets UBTD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3827

  Product name: Recombinant human UBTD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC019910

  Sequence: DSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN

• Full Name: ubiquitin domain containing 2
• Calculated Molecular Weight: 234 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC019910
• Gene Symbol: UBTD2
• Gene ID (NCBI): 92181
• RRID: AB_2210317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUN7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dendritic cell-derived ubiquitin (Ub)-like protein (DC-UbP), also named as Ub domain-containing protein 2 (UBTD2), is a potential Ub shuttle protein comprised of a Ub-like (UbL) domain and a Ub-binding domain (UBD), but its biological function remains largely unknown.PMID: 25207809

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Ann N Y Acad Sci; miR-141-3p affects β-catenin signaling and apoptosis by targeting Ubtd2 in rats with anorectal malformations; Authors - Chen Yi Wang