Urocortin Polyclonal antibody

• 

  IHC staining of human testis using 21951-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21951-1-AP (UCN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 21951-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21951-1-AP (UCN Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human lung cancer using 21951-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 21951-1-AP (UCN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human lung cancer using 21951-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 21951-1-AP (UCN Antibody) at dilution of 1:200 (under 40x lens).

Urocortin Polyclonal Antibody for IHC, ELISA

Cat No. 21951-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

UCN, UROC, UI

---

Tested Applications

• Positive IHC detected in: human testis tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21951-1-AP targets Urocortin in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15995

  Product name: Recombinant human UCN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC104470

  Sequence: MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

• Full Name: urocortin
• Calculated Molecular Weight: 124 aa, 13 kDa
• GenBank Accession Number: BC104470
• Gene Symbol: UCN
• Gene ID (NCBI): 7349
• RRID: AB_2878953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P55089
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Urocortin is a member of the sauvagine/corticotropin-releasing factor/urotensin I family that includes CRF, urotensin I, sauvagine, urocortin II and urocortin III. . Urocortin is a potent anorexigenic peptide that induces fed-like motor activity when administered centrally or peripherally in fasted animals. Urocortin is also a potent and long-lasting hypotensive agent and increases coronary blood flow. Urocortin acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) and binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta. Urocortin is synthesized as precursor, which is subsequently processed to the mature biologically active peptide (a 40-amino acid Molecule ).