UCN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UCN2 Polyclonal antibody (12198-1-AP)

UCN2 Polyclonal Antibody for IHC, ELISA

Cat No. 12198-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SRP, Stresscopin related peptide, UCN II, UCN2, UCNI, UR, urocortin 2, Urocortin II, Urocortin related peptide, URP

• 

  IHC staining of human placenta using 12198-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12198-1-AP (UCN2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 12198-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12198-1-AP (UCN2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UCN2 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12198-1-AP targets UCN2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2836

  Product name: Recombinant human UCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-112 aa of BC022096

  Sequence: FQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Full Name: urocortin 2
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC022096
• Gene Symbol: UCN2
• Gene ID (NCBI): 90226
• RRID: AB_2877835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UCN2, also named as SRP and URP, a member of the CRF family. It is mainly expressed in skin and muscle.

Publications

What published studies show

The UCN2 Polyclonal antibody (Cat# 12198-1-AP) has 1 citation to date. It appears in PLoS One (2025), in a study identifying oxidative stress-responsive genes in recurrent miscarriage and their role in disease pathogenesis. The antibody was used for IHC in human samples. The research falls within the fields of reproductive medicine, oxidative stress biology, and gene expression in obstetric pathology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	PLoS One; Identification of oxidative stress-responsive genes in recurrent miscarriage and their role in disease pathogenesis.; Authors - Mian Wang