UCN2 Polyclonal antibody

• 

  IHC staining of human placenta using 12198-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12198-1-AP (UCN2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 12198-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12198-1-AP (UCN2 Antibody) at dilution of 1:50 (under 40x lens).

UCN2 Polyclonal Antibody for IHC, ELISA

Cat No. 12198-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SRP, Stresscopin related peptide, UCN II, UCN2, UCNI, UR, urocortin 2, Urocortin II, Urocortin related peptide, URP

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12198-1-AP targets UCN2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2836

  Product name: Recombinant human UCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-112 aa of BC022096

  Sequence: FQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Full Name: urocortin 2
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC022096
• Gene Symbol: UCN2
• Gene ID (NCBI): 90226
• RRID: AB_2877835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UCN2, also named as SRP and URP, a member of the CRF family. It is mainly expressed in skin and muscle.