UGCG Polyclonal antibody

• 

  WB analysis of HEK-293 using 33967-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33967-1-AP (UGCG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

UGCG Polyclonal Antibody for WB, ELISA

Cat No. 33967-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Ceramide glucosyltransferase, EC:2.4.1.80, GCS, GLCT-1, Glucosylceramide synthase

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33967-1-AP targets UGCG in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40976

  Product name: Recombinant human UGCG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-195 aa of BC038711

  Sequence: TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPR

• Full Name: UDP-glucose ceramide glucosyltransferase
• Calculated Molecular Weight: 394 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC038711
• Gene Symbol: UGCG
• Gene ID (NCBI): 7357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16739
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UGCG, also named as GCS and GLCT-1, belongs to the glycosyltransferase 2 family. It catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. UGCG may also serve as a "flippase". It is up-regulated at the transcriptional level during keratinocyte differentiation. UGCG is a membrane protein. The calculated MW is 45 kDa. But UGCG is a membrane protein with glycosylation and ubiquitination modifications, resulting in the detection of a weak 75 kDa band.