UGP2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68381-1-Ig (same clone as 68381-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68381-1-Ig (UGP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68381-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68381-1-Ig (same clone as 68381-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68381-1-Ig (UGP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68381-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 68381-1-Ig (same clone as 68381-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68381-1-Ig (UGP2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68381-1-PBS in a different storage buffer formulation.

UGP2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68381-1-PBS

Clone No.1G11G6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, Rat, Pig, Rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

pHC379, UDP glucose pyrophosphorylase, UDPG, UDPGP, UDPGP2, UGP1, UGP2, UGPase, UGPP2

---

Product Information

68381-1-PBS targets UGP2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, Rat, Pig, Rabbit samples.

• Tested Reactivity: Human, mouse, Rat, Pig, Rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33160

  Product name: Recombinant human UGP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-287 aa of BC002954

  Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQY

• Full Name: UDP-glucose pyrophosphorylase 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC002954
• Gene Symbol: UGP2
• Gene ID (NCBI): 7360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16851
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379) is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found.