UGP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 86699-1-RR (same clone as 86699-1-PBS)

  WB result of UGP2 antibody (86699-1-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UGP2 transfected HepG2 cells. This data was developed using the same antibody clone with 86699-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86699-1-RR (same clone as 86699-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86699-1-RR (UGP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86699-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86699-1-RR (same clone as 86699-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using UGP2 antibody (86699-1-RR, Clone: 251615C1 ) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86699-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86699-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86699-1-RR against Human UGP2 were performed. The affinity constant is 0.979 nM.

• Featured Product
• KD/KO Validated

UGP2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86699-1-PBS

Clone No.251615C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.7.7.9, UDPG, UDP-glucose pyrophosphorylase, UDPGP2, UGPase

---

Product Information

86699-1-PBS targets UGP2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0590

  Product name: Recombinant human UGP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-288 aa of BC002954

  Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE

• Full Name: UDP-glucose pyrophosphorylase 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC002954
• Gene Symbol: UGP2
• Gene ID (NCBI): 7360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16851
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379)is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found.