UGT2A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UGT2A1 Polyclonal antibody (24343-1-AP)

UGT2A1 Polyclonal Antibody for WB, ELISA

Cat No. 24343-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, ELISA

Synonyms

EC:2.4.1.17, UDP-glucuronosyltransferase 2A1, UDPGT 2A1, UDPGT2A1, UGT2 A1

• 

  WB analysis using 24343-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24343-1-AP (UGT2A1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UGT2A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24343-1-AP targets UGT2A1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19421

  Product name: Recombinant human UGT2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-124 aa of BC157012

  Sequence: PMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQE

• Full Name: UDP glucuronosyltransferase 2 family, polypeptide A1
• Calculated Molecular Weight: 527 aa, 60 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: BC157012
• Gene Symbol: UGT2A1
• Gene ID (NCBI): 10941
• RRID: AB_2879502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DTE4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UGT2A1 Polyclonal antibody (Cat# 24343-1-AP) has 1 citation to date. It was used in a Western Blot study published in Cell Metabolism (2026), investigating how uridine depletion impairs CD8⁺ T cell antitumor activity through N-glycosylation. The research falls within the fields of immunology, cancer biology, and metabolic regulation of glycosylation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Uridine depletion impairs CD8⁺ T cell antitumor activity through N-glycosylation.; Authors - Jianbiao Xiao