Tested Applications
| Positive WB detected in | SH-SY5Y cells, C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24343-1-AP targets UGT2A1 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19421 Product name: Recombinant human UGT2A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-124 aa of BC157012 Sequence: PMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQE Predict reactive species |
| Full Name | UDP glucuronosyltransferase 2 family, polypeptide A1 |
| Calculated Molecular Weight | 527 aa, 60 kDa |
| Observed Molecular Weight | 50-53 kDa |
| GenBank Accession Number | BC157012 |
| Gene Symbol | UGT2A1 |
| Gene ID (NCBI) | 10941 |
| RRID | AB_2879502 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P0DTE4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for UGT2A1 antibody 24343-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

