UGT2B4 Polyclonal antibody

• 

  WB analysis of human liver using 15425-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15425-1-AP (UGT2B4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15425-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15425-1-AP (UGT2B4 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 15425-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15425-1-AP (UGT2B4 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 15425-1-AP

  Immunofluorescent analysis of HepG2 cells, using UGT2B4 antibody 15425-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

UGT2B4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15425-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UDPGTh 1, UDPGT 2B4, UDP-glucuronosyltransferase 2B4, Hyodeoxycholic acid-specific UDPGT, HLUG25

---

Tested Applications

• Positive WB detected in: human liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15425-1-AP targets UGT2B4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8058

  Product name: Recombinant human UGT2B4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 169-528 aa of BC026264

  Sequence: VYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD

• Full Name: UDP glucuronosyltransferase 2 family, polypeptide B4
• Calculated Molecular Weight: 60.5 kDa
• Observed Molecular Weight: 52-55 kDa
• GenBank Accession Number: BC026264
• Gene Symbol: UGT2B4
• Gene ID (NCBI): 7363
• RRID: AB_2214247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06133
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Drug Metab Dispos; Upregulation of UGT2B4 Expression by 3'-Phosphoadenosine 5'-Phosphosulfate Synthase Knockdown: Implications for Coordinated Control of Bile Acid Conjugation.; Authors - Kathleen G Barrett