UGT2B7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UGT2B7 Polyclonal antibody (16661-1-AP)

• 

  WB analysis using 16661-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16661-1-AP (UGT2B7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16661-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16661-1-AP (UGT2B7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat liver using 16661-1-AP

  IP result of anti-UGT2B7 (IP:16661-1-AP, 4ug; Detection:16661-1-AP 1:3000) with rat liver tissue lysate 4000 ug.

• 

  IHC staining of human liver using 16661-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16661-1-AP (UGT2B7 antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of HepG2 using 16661-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using UGT2B7 antibody (16661-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

UGT2B7 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16661-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

3,4-catechol estrogen-specific UDPGT, EC:2.4.1.17, UDP-glucuronosyltransferase 2B7, UDP-glucuronosyltransferase 2B9, UDPGT 2B7

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HEK-293 cells, rat liver tissue
• Positive IP detected in: rat liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 15 publications below
• IHC: See 2 publications below
• IF: See 4 publications below
• IP: See 1 publications below

Product Information

16661-1-AP targets UGT2B7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10121

  Product name: Recombinant human UGT2B7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-351 aa of BC030974

  Sequence: KVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNT

• Full Name: UDP glucuronosyltransferase 2 family, polypeptide B7
• Calculated Molecular Weight: 529 aa, 61 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC030974
• Gene Symbol: UGT2B7
• Gene ID (NCBI): 7364
• RRID: AB_2214249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16662
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UDP-glucuronosyltransferase 2B7 (UGT2B7), a member of the UDP-glucuronosyltransferase (UGT) superfamily, mediates phase II biotransformation. During this process, lipophilic substrates undergo glucuronidation conjugation with glucuronic acid, which enhances the aqueous solubility of resultant metabolites and accelerates their elimination via urine or bile (PMID: 10702251; 15231852; 15470161; 15472229). UGT2B7 additionally contributes to the metabolic clearance of mycophenolate, an immunosuppressive pharmaceutical agent (PMID: 15470161).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Divergent Expression and Metabolic Functions of Human Glucuronosyltransferases through Alternative Splicing.; Authors - Michèle Rouleau
human	WB	Br J Pharmacol; UDP-Glucuronosyltransferase (UGT)-Mediated Attenuations of Cytochrome P450 3A4 Activity: UGT Isoform-Dependent Mechanism of Suppression.; Authors - Yuu Miyauchi
	WB	Sci Rep; Inter-isoform Hetero-dimerization of Human UDP-Glucuronosyltransferases (UGTs) 1A1, 1A9, and 2B7 and Impacts on Glucuronidation Activity.; Authors - Ling-Min Yuan
human	WB	Sci Rep; Quantitative proteomics by SWATH-MS reveals sophisticated metabolic reprogramming in hepatocellular carcinoma tissues.; Authors - Yanyan Gao
	WB	Biochem Pharmacol; PMID: 25770680; Authors - Lingmin Yuan
	WB	Front Pharmacol; Use of a Baculovirus-Mammalian Cell Expression-System for Expression of Drug-Metabolizing Enzymes: Optimization of Infection With a Focus on Cytochrome P450 3A4.; Authors - Yuu Miyauchi