UGT3A1 Polyclonal antibody

UGT3A1 Polyclonal Antibody for WB, ELISA
Cat No. 17268-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

EC:2.4.1.17, UDP-glucuronosyltransferase 3A1, UDPGT 3A1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse colon tissue, mouse kidney tissue, rat colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17268-1-AP targets UGT3A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11020

Product name: Recombinant human UGT3A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-252 aa of BC035012

Sequence: MLHQSGKFLIPDIKEEEKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYDLVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSFSRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVPQNGQPALFTTPSLFSSGVYPEPLRRL

Predict reactive species
Full Name UDP glycosyltransferase 3 family, polypeptide A1
Calculated Molecular Weight 59 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC035012
Gene Symbol UGT3A1
Gene ID (NCBI) 133688
RRIDAB_2304309
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6NUS8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UGT3A1 (UDP Glycosyltransferase Family 3 Member A1) belongs to UDP-Glucuronosyltransferases (UGTs) superfamily. UGTs are membrane-bound enzymes localized at the subcellular level in the endoplasmic reticulum (ER) with an active site facing the lumenal side of the ER membrane. The genetic variation in UGT enzymes can modulate its regulation and expression, influencing UGT activity and resulting in pharmacological and physiologic effects. UGT3 family enzymes (UGT3A1 and UGT3A2) are expressed in the thymus, testis, and kidney, with a potential role in the metabolism of ursodeoxycholic acid during the treatment of cholestasis or gallstones.

Protocols

Product Specific Protocols
WB protocol for UGT3A1 antibody 17268-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...