ULBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ULBP1 Polyclonal antibody (17715-1-AP)

ULBP1 Polyclonal Antibody for WB, ELISA

Cat No. 17715-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ALCAN beta, N2DL 1, N2DL1, NKG2D ligand 1, NKG2DL1, RAET1I, UL16 binding protein 1, ULBP1

• 

  WB analysis of HEK-293 using 17715-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 17715-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ULBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17715-1-AP targets ULBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12079

  Product name: Recombinant human ULBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-244 aa of BC035416

  Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR

• Full Name: UL16 binding protein 1
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035416
• Gene Symbol: ULBP1
• Gene ID (NCBI): 80329
• RRID: AB_2214685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-NKG2D antibody (Cat# 17715-1-AP) has 17 citations. They appear in journals including Science Advances, Neuron, Cancer Biology & Medicine, Cancer Letters, Food Research International, International Journal of Molecular Medicine, Frontiers in Immunology, ACS Biomaterials Science & Engineering, International Journal of Pharmaceutics, International Immunopharmacology, Cell Oncology, Molecular Neurobiology, Molecular Immunology, Histochemistry and Cell Biology, Gene, Frontiers in Oncology, and Cell Reports Medicine. Research fields span NK cell immunology, cancer immunotherapy, CAR-T therapy, tumor microenvironment, and inflammation.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Adv; γδ-Enriched CAR-T cell therapy for bone metastatic castrate-resistant prostate cancer; Authors - Jeremy S Frieling
mouse	WB	Cancer Biol Med; The PI3K/Akt/GSK-3β/ROS/eIF2B pathway promotes breast cancer growth and metastasis via suppression of NK cell cytotoxicity and tumor cell susceptibility.; Authors - Fengjiao Jin
human	WB	Cancer Lett; Pleckstrin-2 promotes tumour immune escape from NK cells by activating the MT1-MMP-MICA signalling axis in gastric cancer; Authors - Deli Mao
human,mouse	WB	Food Res Int; Xylooligosaccharides ameliorate intestinal barrier injury by inhibiting apoptosis, RhoA/ROCK/MLCK signaling and NKG2DLs in intestinal epithelial cells.; Authors - Junyi Yang
human	IHC	Int J Mol Med; Dormancy and NKG2D system in brain metastases: Analysis of immunogenicity.; Authors - Charlotte Flüh
mouse	WB,IHC	Front Immunol; Extracellular CIRP augments inflammation in acute kidney injury via NKG2D-positive macrophages.; Authors - Fangming Zhang