ULBP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ULBP2 Polyclonal antibody (13133-1-AP)

ULBP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13133-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ALCAN alpha, N2DL 2, N2DL2, NKG2D ligand 2, NKG2DL2, RAET1H, UL16 binding protein 2, ULBP2

• 

  WB analysis of Jurkat using 13133-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13133-1-AP (ULBP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13133-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13133-1-AP (ULBP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13133-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13133-1-AP (ULBP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13133-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13133-1-AP (ULBP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13133-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13133-1-AP (ULBP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ULBP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human liver cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13133-1-AP targets ULBP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3798

  Product name: Recombinant human ULBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-224 aa of BC034689

  Sequence: AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA

• Full Name: UL16 binding protein 2
• Calculated Molecular Weight: 246 aa, 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC034689
• Gene Symbol: ULBP2
• Gene ID (NCBI): 80328
• RRID: AB_2214691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NKG2D is an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells.

Publications

What published studies show

The ULBP2 Polyclonal antibody (Cat# 13133-1-AP) has 6 total citations. These appear in journals including Cell Death & Disease, Cancer Letters, International Journal of Biological Sciences, International Immunopharmacology, Cell Oncology, and Journal of Stomatology, Oral and Maxillofacial Surgery. The research fields span cancer immunotherapy, NK cell biology, and tumor progression in gastric cancer, liver cancer, AML, triple-negative breast cancer, and head and neck squamous cell carcinoma.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Death Dis; ULBP2 CAR-T cells enhance gastric cancer immunotherapy by inhibiting CAF activation.; Authors - Wentao Zhang
human	WB	Cancer Lett; Pleckstrin-2 promotes tumour immune escape from NK cells by activating the MT1-MMP-MICA signalling axis in gastric cancer; Authors - Deli Mao
human	WB	Int J Biol Sci; CD44 3'-Untranslated Region Functions as a Competing Endogenous RNA to Enhance NK Sensitivity of Liver Cancer Stem Cell by Regulating ULBP2 Expression.; Authors - Jun Weng
human	WB	Cell Oncol (Dordr); TAK-981 potentiates doxorubicin immunocide in triple-negative breast cancer by IFN I-dependent NK cell stimulation.; Authors - Jia Liu
human	WB	Int Immunopharmacol; Venetoclax enhances NK cell killing sensitivity of AML cells through the NKG2D/NKG2DL activation pathway.; Authors - Hui-Yang Wu
human	WB	J Stomatol Oral Maxillofac Surg; ULBP2 promotes progression of head and neck squamous cell carcinoma by modulating MAPK signaling pathway; Authors - Wei Xu ; KD Validated