ULBP2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67249-1-Ig (same clone as 67249-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67249-1-Ig (ULBP2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67249-1-PBS in a different storage buffer formulation.

ULBP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67249-1-PBS

Clone No.1A9G8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

ALCAN alpha, N2DL 2, N2DL2, NKG2D ligand 2, NKG2DL2, RAET1H, UL16 binding protein 2, ULBP2

---

Product Information

67249-1-PBS targets ULBP2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28879

  Product name: Recombinant human ULBP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-224 aa of BC034689

  Sequence: AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA

• Full Name: UL16 binding protein 2
• Calculated Molecular Weight: 246 aa, 27 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC034689
• Gene Symbol: ULBP2
• Gene ID (NCBI): 80328
• RRID: AB_2882526
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BZM5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NKG2D an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells.