ULBP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83709-1-RR (same clone as 83709-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83709-1-RR (ULBP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83709-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 83709-1-RR (same clone as 83709-1-PBS)

  WB result of ULBP2 antibody (83709-1-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ULBP2 transfected Jurkat cells. This data was developed using the same antibody clone with 83709-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 83709-1-RR (same clone as 83709-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83709-1-RR (ULBP2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83709-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 83709-1-RR (same clone as 83709-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83709-1-RR (ULBP2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83709-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83709-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83709-1-RR against Human ULBP2 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

ULBP2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83709-1-PBS

Clone No.240413A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

240413A6, ALCAN alpha, ALCAN-alpha, N2DL2, N2DL-2

---

Product Information

83709-1-PBS targets ULBP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0858

  Product name: Recombinant Human ULBP2 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-217 aa of NM_025217.4

  Sequence: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

• Full Name: UL16 binding protein 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_025217.4
• Gene Symbol: ULBP2
• Gene ID (NCBI): 80328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BZM5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NKG2D is an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells.