UNG Monoclonal antibody

• 

  WB analysis of HepG2 using 67490-1-Ig

  WB result of UNG antibody (67490-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UNG transfected HepG2 cells.

• 

  WB analysis using 67490-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67490-1-Ig (UNG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67490-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67490-1-Ig (UNG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67490-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67490-1-Ig (UNG antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 67490-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67490-1-Ig (UNG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

UNG Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67490-1-Ig

Clone No.2B3B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

2B3B2, DGU, EC:3.2.2.27, UNG1, Uracil-DNA glycosylase

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, HT-29 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67490-1-Ig targets UNG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29979

  Product name: Recombinant human UNG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-304 aa of BC015205

  Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

• Full Name: uracil-DNA glycosylase
• Calculated Molecular Weight: 304 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC015205
• Gene Symbol: UNG
• Gene ID (NCBI): 7374
• RRID: AB_2918492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13051
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.