UNG Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• UNG Recombinant monoclonal antibody, PBS Only (86880-6-PBS)

UNG Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86880-6-PBS

Clone No.251858B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DGU, EC:3.2.2.27, UNG1, Uracil-DNA glycosylase

• 

  WB analysis using 86880-6-RR (same clone as 86880-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86880-6-RR (UNG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86880-6-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86880-6-PBS targets UNG in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3072

  Product name: Recombinant human UNG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC015205

  Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

• Full Name: uracil-DNA glycosylase
• Calculated Molecular Weight: 304 aa, 34 kDa
• Observed Molecular Weight: 28 kDa, 34-40 kDa
• GenBank Accession Number: BC015205
• Gene Symbol: UNG
• Gene ID (NCBI): 7374
• RRID: AB_3745182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13051
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930). Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5).