UNK Polyclonal antibody

• 

  WB analysis using 31574-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31574-1-AP (UNK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 31574-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 31574-1-AP (UNK antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 31574-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using UNK antibody (31574-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 31574-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using UNK antibody (31574-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

UNK Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31574-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ZC3HDC5, ZC3H5, unkempt homolog (Drosophila), KIAA1753

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells
• Positive IF/ICC detected in: HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31574-1-AP targets UNK in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36222

  Product name: Recombinant human UNK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 640-810 aa of BC053362

  Sequence: SGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS

• Full Name: unkempt homolog (Drosophila)
• Observed Molecular Weight: 88~100 kDa
• GenBank Accession Number: BC053362
• Gene Symbol: UNK
• Gene ID (NCBI): 85451
• RRID: AB_3670041
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9C0B0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Unkempt (UNK) is a sequence-specific RNA-binding protein which plays an important role in the establishment and maintenance of the early morphology of cortical neurons during embryonic development. UNK gene encodes a zinc finger/RING domain containing protein, as a negative regulator of the timing of photoreceptor differentiation.