UPP1 Polyclonal antibody

• 

  WB analysis of U2OS using 14186-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 14186-1-AP (UPP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 14186-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 14186-1-AP (UPP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse small intestine using 14186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 14186-1-AP (UPP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 14186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 14186-1-AP (UPP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UPP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14186-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

UDRPASE, UP, UPASE, UPase 1, UPP, UPP1, UrdPase 1, uridine phosphorylase 1

---

Tested Applications

• Positive WB detected in: U2OS cells, SGC-7901 cells
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

14186-1-AP targets UPP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5441

  Product name: Recombinant human UPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-173 aa of BC047030

  Sequence: MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

• Full Name: uridine phosphorylase 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC047030
• Gene Symbol: UPP1
• Gene ID (NCBI): 7378
• RRID: AB_2878025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Arthritis Rheumatol; SHP2 inhibition attenuates osteoarthritis by maintaining homeostasis of cartilage metabolism via the DOK1/UPP1/uridine cascade.; Authors - Qianqian Liu
human,mouse	WB,IHC	Oncogene; Transcriptional reprogramming triggered by neonatal UV radiation or Lkb1 loss prevents BRAFV600E-induced growth arrest in melanocytes; Authors - Kimberley McGrail
Mouse		PLoS One; Pharmacological inhibition of catalase induces peroxisome leakage and suppression of LPS induced inflammatory response in Raw 264.7 cell.; Authors - Yizhu Mu
human,mouse	WB,IHC,IF	Nat Commun; UPP1 promotes lung adenocarcinoma progression through the induction of an immunosuppressive microenvironment; Authors - Yin Li
human	WB	Cancer Cell Int; p53 activation enhances the sensitivity of non-small cell lung cancer to the combination of SH003 and docetaxel by inhibiting de novo pyrimidine synthesis; Authors - Yu-Jeong Choi
human	WB	Oncogene; The protection of UCK2 protein stability by GART maintains pyrimidine salvage synthesis for HCC growth under glucose limitation; Authors - Nannan Sha