UPP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UPP1 Polyclonal antibody (14186-1-AP)

UPP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14186-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

EC:2.4.2.3, UDRPASE, UP, UPASE, UPase 1

• 

  WB analysis of U2OS using 14186-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 14186-1-AP (UPP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SGC-7901 using 14186-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 14186-1-AP (UPP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 14186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 14186-1-AP (UPP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UPP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells, SGC-7901 cells
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14186-1-AP targets UPP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5441

  Product name: Recombinant human UPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-173 aa of BC047030

  Sequence: MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

• Full Name: uridine phosphorylase 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC047030
• Gene Symbol: UPP1
• Gene ID (NCBI): 7378
• RRID: AB_2878025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Uridine phosphorylase 1 (UPP1) belongs to the purine/pyrimidine phosphorylase family. It is an enzyme that catalyzes the reversible conversion of uridine to uracil and ribose-1-phosphate. UPP1 plays a crucial role in pyrimidine metabolism. UPP1 is highly expressed in various cancers, aiding in metabolic reprogramming, tumor growth, and immune evasion. The apparent molecular mass measured by SDS-PAGE is 34 kDa. The post-translational modification of UPP1 is primarily ubiquitination.

Publications

What published studies show

Anti-UPP1 antibody (Cat# 14186-1-AP) has accumulated 14 citations across journals including Nature Communications, Cell Metabolism, Journal of Clinical Investigation, Oncogene, Arthritis & Rheumatology, Cell Signaling, Laboratory Investigation, Science Reports, and PLoS One. Research fields encompass oncology (lung, pancreatic, esophageal, oral, and brain cancers), pyrimidine metabolism, immunology, epigenetics, and inflammatory conditions such as psoriasis and osteoarthritis.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Uridine depletion impairs CD8⁺ T cell antitumor activity through N-glycosylation.; Authors - Jianbiao Xiao
mouse,human	WB,IHC,IF	Nat Commun; UPP1 promotes lung adenocarcinoma progression through the induction of an immunosuppressive microenvironment; Authors - Yin Li
mouse	WB	J Clin Invest; Targeting plasticity in the pyrimidine synthesis pathway potentiates macrophage-mediated phagocytosis in pancreatic cancer models.; Authors - Jie Zhao ; KO Validated
human	IF	Int J Biol Sci; Comprehensive Metabolomic Profiling of Skin Lesions from Psoriasis Patients Reveals Disease Signatures.; Authors - Peiyao Zhu
human	WB	Cell Commun Signal; U2AF2-regulated alternative splicing of UPP1 promotes NSCLC progression by enhancing glycolysis.; Authors - Hongyu Pan
mouse	WB,IHC	Arthritis Rheumatol; SHP2 inhibition attenuates osteoarthritis by maintaining homeostasis of cartilage metabolism via the DOK1/UPP1/uridine cascade.; Authors - Qianqian Liu