Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 2 publications below |
Product Information
14793-1-AP targets UQCR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6491 Product name: Recombinant human UQCR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC000462 Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN Predict reactive species |
| Full Name | ubiquinol-cytochrome c reductase, 6.4kDa subunit |
| Calculated Molecular Weight | 6 kDa |
| Observed Molecular Weight | 6 kDa |
| GenBank Accession Number | BC000462 |
| Gene Symbol | UQCR |
| Gene ID (NCBI) | 10975 |
| RRID | AB_1557751 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14957 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UQCR antibody 14793-1-AP | Download protocol |
| WB protocol for UQCR antibody 14793-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Chem Biol Designing chemigenetic DNA nanotrap for norepinephrine dynamic imaging in organelles. | ||
Front Immunol Exploring the role of mitochondrial metabolism and immune infiltration in myocardial infarction: novel insights from bioinformatics and experimental validation | ||
Cell Stem Cell Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance |







