UQCRH Polyclonal antibody

• 

  IHC staining of human breast cancer using 12364-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12364-1-AP (UQCRH antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12364-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12364-1-AP (UQCRH antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12364-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 12364-1-AP (UQCRH antibody) at dilution of 1:50 (under 10x lens).

UQCRH Polyclonal Antibody for IHC, ELISA

Cat No. 12364-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Complex III subunit 6, Complex III subunit VIII, Mitochondrial hinge protein, QCR6, UQCRH

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12364-1-AP targets UQCRH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3037

  Product name: Recombinant human UQCRH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC015177

  Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

• Full Name: ubiquinol-cytochrome c reductase hinge protein
• Calculated Molecular Weight: 91 aa, 11 kDa
• GenBank Accession Number: BC015177
• Gene Symbol: UQCRH
• Gene ID (NCBI): 7388
• RRID: AB_2877850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07919
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCRH(ubiquinol-cytochrome c reductase hinge protein) belongs to the UQCRH/QCR6 family. It is a part of the mitochondrial respiratory chain that may mediate formation of the complex between cytochromes c and c1. The deduced 91-amino acid protein has a 13-amino acid N-terminal mitochondrial targeting presequence.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Adv Sci (Weinh); Aloe Emodin Alleviates Radiation-Induced Heart Disease via Blocking P4HB Lactylation and Mitigating Kynurenine Metabolic Disruption; Authors - Fan Ouyang