Tested Applications
| Positive WB detected in | HepG2 cells, human liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14975-1-AP targets UQCRQ in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6886 Product name: Recombinant human UQCRQ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001390 Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK Predict reactive species |
| Full Name | ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001390 |
| Gene Symbol | UQCRQ |
| Gene ID (NCBI) | 27089 |
| RRID | AB_2288356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14949 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| IHC protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| IP protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| WB protocol for UQCRQ antibody 14975-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UQCRQ Polyclonal antibody (Cat# 14975-1-AP) has 19 citations across journals including Nature Aging, Advanced Science, Cell Death & Disease, Pharmacological Research, Free Radical Biology and Medicine, Journal of Biological Chemistry, FASEB Journal, Stem Cells, iScience, Human Molecular Genetics, and EMBO Reports. Research fields span mitochondrial oxidative phosphorylation, diabetic cardiomyopathy, cancer metabolism, neurodegeneration, stem cell biology, and reproductive medicine.
| Species | Application | Title |
|---|---|---|
Nat Aging Scinderin promotes fusion of electron transport chain dysfunctional muscle stem cells with myofibers. | ||
Adv Sci (Weinh) Impaired Iron-Sulfur Cluster Synthesis Induces Mitochondrial PARthanatos in Diabetic Cardiomyopathy | ||
Pharmacol Res Discovery of KMT5A repressed miR-99b cluster with potential to restore chemotherapy sensitivity in gastric cancer by regulating mitochondrial complex II and affecting OXPHOS. | ||
Cell Death Dis Calcium sensing receptor protects high glucose-induced energy metabolism disorder via blocking gp78-ubiquitin proteasome pathway. | ||
Free Radic Biol Med Low-intensity pulsed ultrasound ameliorates pancreatic injury and glucose metabolism in type 2 diabetic mice: regulatory role of the oxidative phosphorylation pathway. | ||
J Ethnopharmacol Guilu Erxian oral liquid alleviates oligoasthenospermia via the mitochondria-complement-NETs network. |
Reviews
What customers say
One reviewer (Annabel M.) used this antibody for Western Blot on B cells at a 1:1000 dilution (Lot 00080709) and gave it a 5-star rating. She reported that the antibody produces a single band with a strong signal, and noted she imaged the blot using a blotting accelerator. Overall, the feedback is positive, highlighting clean specificity and strong signal intensity in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Annabel (Verified Customer) (12-23-2025) | Produces a single band and strong signal. Imaged using blotting accelerator
 |
