USB1 Polyclonal antibody

• 

  WB analysis using 21229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21229-1-AP (USB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

USB1 Polyclonal Antibody for WB, ELISA

Cat No. 21229-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C16orf57, 3'-5' RNA exonuclease USB1, EC:4.6.1.-, hMpn1, hUsb1

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21229-1-AP targets USB1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15689

  Product name: Recombinant human C16orf57 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-265 aa of BC004415

  Sequence: MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK

• Full Name: chromosome 16 open reading frame 57
• Calculated Molecular Weight: 265 aa, 30 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC004415
• Gene Symbol: C16orf57
• Gene ID (NCBI): 79650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ65
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USB1 (U6 snRNA biogenesis phosphodiesterase 1) is a key nuclease primarily located within the nucleus and responsible for RNA processing. Its most well-defined function is to catalyze the hydrolysis of the 2',3'-cyclic phosphate at the 3' end of the U6 small nuclear RNA (snRNA), generating an essential 3'-hydroxyl group. This process is crucial for spliceosome assembly and pre-mRNA splicing. Mutations in the USB1 gene directly cause cartilaginous-hair hypoplasia, a rare autosomal recessive genetic disorder. Affected individuals present with short-limbed dwarfism, sparse hair, immunodeficiency, and bone marrow failure, revealing the critical roles of USB1 in skeletal development, cell cycle regulation, and immune system function. Therefore, USB1 is not only a core factor in RNA metabolism but also an important disease-associated protein.