USE1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USE1 Polyclonal antibody (25218-1-AP)

• Featured Product
• KD/KO Validated

USE1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25218-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MDS032, p31, Putative MAPK-activating protein PM26, SLT1, USE1 like protein

• 

  WB analysis of HEK-293 using 25218-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25218-1-AP (USE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25218-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25218-1-AP (USE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 25218-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25218-1-AP (USE1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 25218-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25218-1-AP (USE1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USE1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25218-1-AP targets USE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18587

  Product name: Recombinant human USE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-231 aa of BC008455

  Sequence: MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVN

• Full Name: unconventional SNARE in the ER 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 259 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC008455
• Gene Symbol: USE1
• Gene ID (NCBI): 55850
• RRID: AB_2879966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ43
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USE1(Vesicle transport protein USE1) is also named as USE1L, p31 and belongs to the USE1 family. It may be an essential molecule involved in the maintenance of ER morphology (and its deficiency leads to ER stress-induced apoptosis). USE1 also participates in the degradative function of lysosomes. This protein has 3 isoforms produced by alternative splicing.

Publications

What published studies show

The USE1 Polyclonal antibody (Cat# 25218-1-AP) has a total of 3 citations. These appear in Genome Research, PLoS Pathogens, and Journal of Cell Science. The associated research fields include xenotransplantation and gene editing, viral glycosylation and propagation (mumps virus), and chaperone client protein identification (TRC40). All three citations used the antibody for Western blot (WB) applications in human and/or mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Genome Res; Homozygous editing of multiple genes for accelerated generation of xenotransplantation pigs; Authors - Xiaoyue Duan
human	WB	PLoS Pathog; SNARE protein USE1 is involved in the glycosylation and the expression of mumps virus fusion protein and important for viral propagation; Authors - Yaqing Liu ; KD Validated
human	WB	J Cell Sci; A trap mutant reveals the physiological client spectrum of TRC40.; Authors - Javier Coy-Vergara