Tested Applications
| Positive WB detected in | mouse brain tissue, human liver tissue, human brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17716-1-AP targets USMG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12086 Product name: Recombinant human USMG5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-58 aa of BC072683 Sequence: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT Predict reactive species |
| Full Name | up-regulated during skeletal muscle growth 5 homolog (mouse) |
| Calculated Molecular Weight | 58 aa, 7 kDa |
| Observed Molecular Weight | 6 kDa |
| GenBank Accession Number | BC072683 |
| Gene Symbol | USMG5 |
| Gene ID (NCBI) | 84833 |
| RRID | AB_2214288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96IX5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for USMG5 antibody 17716-1-AP | Download protocol |
| WB protocol for USMG5 antibody 17716-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The USMG5 Polyclonal antibody (Cat# 17716-1-AP) has 5 citations across journals including J Clin Invest, EBioMedicine, Mol Psychiatry, Sci Rep, and Prog Neurobiol. Research fields span congenital myopathy, mitochondrial disease and metabolic reprogramming, ubiquitination in fear memory, Duchenne muscular dystrophy, and mitochondrial homeostasis in peripheral nerves. Applications cited include WB and IF in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
EBioMedicine Homozygous variant in translocase of outer mitochondrial membrane 7 leads to metabolic reprogramming and microcephalic osteodysplastic dwarfism with moyamoya disease | ||
Mol Psychiatry Proteasome-independent K63 polyubiquitination selectively regulates ATP levels and proteasome activity during fear memory formation in the female amygdala | ||
Sci Rep miR-379 links glucocorticoid treatment with mitochondrial response in Duchenne muscular dystrophy. | ||
Prog Neurobiol The low-density lipoprotein receptor-related protein-1 (LRP1) in Schwann cells controls mitochondria homeostasis in peripheral nerves |
Reviews
What customers say
The antibody performed well in histoblot on fresh frozen human brain tissue at a 1:500 dilution in 2.5% milk with an overnight incubation at 4°C. The reviewer reported specific staining and highly reproducible results, giving the product a top rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Carmen (Verified Customer) (02-05-2026) | Fresh frozen human brain tissue sections were subjected to histoblot with 17716-1-AP (USMG5 antibody) at dilution of 1:500 in 2.5% milk (incubated at 4ºC temperature overnight). The staining was specific and the results highly reproducible.
 |
