USP15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP15 Polyclonal antibody (14354-1-AP)

• Featured Product
• KD/KO Validated

USP15 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14354-1-AP Copied!

Publications (34)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Deubiquitinating enzyme 15, EC:3.4.19.12, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Ubiquitin thioesterase 15

• 

  WB analysis of HeLa using 14354-1-AP

  WB result of USP15 antibody (14354-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP15 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 14354-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14354-1-AP (USP15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14354-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14354-1-AP (USP15 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14354-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14354-1-AP (USP15 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14354-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14354-1-AP (USP15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14354-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14354-1-AP (USP15 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14354-1-AP

  IP result of anti-USP15 (IP:14354-1-AP, 4ug; Detection:14354-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14354-1-AP (USP15 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14354-1-AP (USP15 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14354-1-AP (USP15 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14354-1-AP (USP15 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14354-1-AP (USP15 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14354-1-AP (USP15 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14354-1-AP (USP15 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 14354-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14354-1-AP (USP15 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP15 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue, HepG2 cells, K-562 cells, MCF-7 cells, NIH/3T3 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human placenta tissue, human breast cancer tissue, human lung tissue, human ovary tumor tissue, mouse kidney tissue, rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14354-1-AP targets USP15 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5703

  Product name: Recombinant human USP15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC020688

  Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC

• Full Name: ubiquitin specific peptidase 15
• Calculated Molecular Weight: 112 kDa
• Observed Molecular Weight: 112 kDa
• GenBank Accession Number: BC020688
• Gene Symbol: USP15
• Gene ID (NCBI): 9958
• RRID: AB_2257148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4E8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin is a highly conserved eukaryotic protein that is synthesized as a fusion protein precursor, either to itself or to one of two ribosomal proteins. USP15, is also named as KIAA0529,Unph-2, Unph4, encoding a human ubiquitin-specific protease (USP). The USP15 protein contains the highly conserved Cys and His boxes present in all members of he UBP family of deubiquitinating enzymes(PMID:10444327).It has 3 isoforms produced by alternative splicing.

Publications

What published studies show

USP15 antibody (Cat# 14354-1-AP) has 34 citations across journals including Nature Immunology, Nature Communications, Molecular Cell, Autophagy, Science Advances, Oncogene, Leukemia, Cell Reports, Cancer Letters, Cell Death & Disease, Free Radical Biology and Medicine, and Cell Death Discovery. Research fields span cancer biology (hepatocellular carcinoma, breast cancer, glioblastoma, leukemia), neurodegeneration, tumor immunotherapy, autophagy, oxidative stress, wound healing, antiviral immunity, cardiovascular injury, and ferroptosis.

Automatically generated from the 34 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; USP15 stabilizes MDM2 to mediate cancer-cell survival and inhibit antitumor T cell responses.; Authors - Qiang Zou ; KO Validated
mouse	WB	Autophagy; LncRNA 2810403D21Rik/Mirf promotes ischemic myocardial injury by regulating autophagy through targeting Mir26a.; Authors - Haihai Liang
human	WB	Autophagy; USP33 deubiquitinates PRKN/parkin and antagonizes its role in mitophagy.; Authors - Kaifeng Niu ; KD Validated
mouse,human	WB	Nat Commun; ERK and USP5 govern PD-1 homeostasis via deubiquitination to modulate tumor immunotherapy; Authors - Xiangling Xiao ; KD Validated
mouse	WB	Mol Cell; RAPIDASH: Tag-free enrichment of ribosome-associated proteins reveals composition dynamics in embryonic tissue, cancer cells, and macrophages; Authors - Teodorus Theo Susanto
human	WB	Sci Adv; ITCH regulates Golgi integrity and proteotoxicity in neurodegeneration.; Authors - Qiwang Xiang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating from a Western Blot application on U2OS cell lysates. The reviewer reported a clean band and noted they used a dilution of 1:500, which was lower than the dilution recommended in the datasheet. Overall, the feedback is positive, highlighting strong performance and clean results in WB.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Amy (Verified Customer) (11-08-2023)

Clean band for WB, used at a dilution lower than in the data sheet for U2OS cell lysates (1:500).

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: U2OS