USP16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP16 Polyclonal antibody (14055-1-AP)

• Featured Product
• KD/KO Validated

USP16 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14055-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

EC:3.4.19.12, MSTP039, Ubiquitin carboxyl-terminal hydrolase 16, Ubiquitin thioesterase 16, Ubiquitin-processing protease UBP-M

• 

  WB analysis using 14055-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14055-1-AP (USP16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 14055-1-AP

  IP result of anti-USP16 (IP:14055-1-AP, 5ug; Detection:14055-1-AP 1:1000) with HeLa cells lysate 880ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 14055-1-AP (USP16 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14055-1-AP (USP16 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP16 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver tissue, human heart tissue, mouse kidney tissue, human skin tissue, human placenta tissue, rat pancreas tissue, human ovary tissue, human brain tissue, human testis tissue, human kidney tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14055-1-AP targets USP16 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4981

  Product name: Recombinant human USP16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-386 aa of BC030777

  Sequence: MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSL

• Full Name: ubiquitin specific peptidase 16
• Calculated Molecular Weight: 94 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC030777
• Gene Symbol: USP16
• Gene ID (NCBI): 10600
• RRID: AB_2272832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5T5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP16 (Ubiquitin specific peptidase 16) was originally identified as a DUB of histone H2A which is implicated in cell cycle progression and HOXD10 gene expression (PMID:17914355). The knockout study has reported that depletion of USP16 results in early embryonic lethality in mice (PMID:24784029). Moreover, USP16 mediated the deubiquitination and stabilization of Drp1 through its direct interaction with Drp1 (PMID:37488647).

Publications

What published studies show

The antibody targets USP16 (Cat# 14055-1-AP), with a total of 10 citations. These appear in journals including Nature Communications, Genome Medicine, Oncogene, JCI Insight, Arthritis Research & Therapy, Journal of Cell Science, Scientific Reports, Rheumatology (Oxford), and Cytotechnology. Research fields span hepatic ischemia-reperfusion injury, myopia progression, lung adenocarcinoma, psoriasis, gouty arthritis, nuclear export mechanisms, cancer cytotoxicity, systemic sclerosis fibrosis, and macrophage polarization in colorectal cancer.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Nat Commun; FGF18 alleviates hepatic ischemia-reperfusion injury via the USP16-mediated KEAP1/Nrf2 signaling pathway in male mice; Authors - Gaozan Tong ; KD Validated
human	IF	Genome Med; Intermittent myopic visual exposure triggers myopia progression via H3K27me3.; Authors - Yi Lei
		Oncogene; HERC4 synergizes with USP16 to promote lung adenocarcinoma growth by augmenting protein translation via stabilizing RPS15.; Authors - Qiuyun Jiang
mouse,human	IHC	JCI Insight; USP16 drives psoriasis progression by deubiquitinating and stabilizing NLRP3 in keratinocytes.; Authors - Nan Wang
mouse	WB,CoIP	Arthritis Res Ther; Deubiquitinase USP16 induces gouty arthritis via Drp1-dependent mitochondrial fission and NLRP3 inflammasome activation; Authors - Qingdong Wang ; KD Validated
human	WB,IF	J Cell Sci; A potent nuclear export mechanism imposes USP16 cytoplasmic localization during interphase; Authors - Nadine Sen Nkwe