USP19 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP19 Polyclonal antibody (25768-1-AP)

• Featured Product
• KD/KO Validated

USP19 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25768-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

EC:3.4.19.12, KIAA0891, Ubiquitin carboxyl-terminal hydrolase 19, Ubiquitin thioesterase 19, Ubiquitin-specific-processing protease 19

• 

  WB analysis of Jurkat using 25768-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 25768-1-AP

  WB result of USP19 antibody (25768-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP19 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 25768-1-AP

  IP result of anti-USP19 (IP:25768-1-AP, 4ug; Detection:25768-1-AP 1:500) with Jurkat cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP19 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, Jurkat cells, MDA-MB-231 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25768-1-AP targets USP19 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22646

  Product name: Recombinant human USP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-500 aa of BC146752

  Sequence: VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV

• Full Name: ubiquitin specific peptidase 19
• Calculated Molecular Weight: 1318 aa, 146 kDa
• Observed Molecular Weight: 70 kDa, 120 kDa, 150-180 kDa
• GenBank Accession Number: BC146752
• Gene Symbol: USP19
• Gene ID (NCBI): 10869
• RRID: AB_2713918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94966
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin-specific protease (USP)19 is a recently identified deubiquitinating enzyme (DUB) having multiple splice variants and cellular functions. Since the sum of molecular weights of the two small bands (65 kDa+120 kDa) approximates the size of the full-length protein (~185 kDa), USP19 is likely to be endoproteolytically cleaved. Interestingly, the small bands were not observed when the DUB activity was inactivated, suggesting that the cleavage of USP19 depends on its DUB activity (PMID: 25088257).

Publications

What published studies show

The USP19 Polyclonal antibody (catalog number 25768-1-AP) has 18 citations. These appear in journals including Molecular Cell, Theranostics, Advanced Science, Cell Death & Differentiation, Cancer Letters, Molecular Therapy, Clinical & Translational Medicine, Cell & Molecular Life Sciences, Journal of Cell Biology, Cells, Cell Biology & Toxicology, Scientific Reports, Journal of Alzheimer's Disease, Molecular Biotechnology, OncoTargets and Therapy, Current Medical Science, and Open Medicine. Research fields span ubiquitin signaling, deubiquitination, ferroptosis, autophagy, mitochondrial dynamics, and multiple cancers (hepatocellular, pancreatic, breast, cervical, ovarian, gastric), plus ALS and phenylketonuria.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; An Interaction Landscape of Ubiquitin Signaling.; Authors - Xiaofei Zhang
human	WB	Theranostics; Targeting USP11 counteracts SFTPCI73T -associated interstitial lung disease in hiPSCs-derived alveolar organoids and in vivo models; Authors - Janardhan Keshav Karapurkar
human	WB	Theranostics; USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2; Authors - Arun Pandian Chandrasekaran ; KD Validated
human	WB	Adv Sci (Weinh); ZDHHC2-Dependent Palmitoylation Dictates Ferroptosis and Castration Sensitivity in Prostate Cancer via Controlling ACSL4 Degradation and Lipid Peroxidation; Authors - Shuai Shao
human	WB,IP,IHC,IF	Cell Death Differ; USP19 potentiates autophagic cell death via inhibiting mTOR pathway through deubiquitinating NEK9 in pancreatic cancer; Authors - Guangfu Wang ; KD Validated
human	WB,IHC,CoIP	Cancer Lett; The deubiquitinating enzyme USP19 facilitates hepatocellular carcinoma progression through stabilizing YAP; Authors - Zelin Tian ; KD Validated