Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse brain tissue, mouse kidney tissue, MCF-7 cells, HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue, human skeletal muscle tissue, mouse kidney tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse embryo tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10392-1-AP targets USP2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0591 Product name: Recombinant human USP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-241 aa of BC002955 Sequence: YTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGK Predict reactive species |
| Full Name | ubiquitin specific peptidase 2 |
| Calculated Molecular Weight | 41 kDa, 69 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC002955 |
| Gene Symbol | USP2 |
| Gene ID (NCBI) | 9099 |
| RRID | AB_2212432 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75604 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin, a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). USP2 is also named as UBP41. USP2 can interact indirectly with multiple clock proteins, so it remains possible that USP2 may modulate the ubiquitination and function of these other proteins. It has 4 isoforms produced by alternative splicing. This antibody is specific to the isoform 1(USP2a) of USP2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for USP2 antibody 10392-1-AP | Download protocol |
| IHC protocol for USP2 antibody 10392-1-AP | Download protocol |
| WB protocol for USP2 antibody 10392-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
USP2 antibody (Cat# 10392-1-AP) has 35 citations published in journals including Gastroenterology, Acta Pharm Sin B, Adv Sci, Cell Death Dis, Cancer Lett, Int J Biol Sci, J Immunother Cancer, Cell Death Discov, Diabetes, Free Radic Biol Med, Cell Rep, mBio, FASEB J, iScience, and others. Research fields span oncology (lung, breast, liver, melanoma, colorectal, leukemia), immunology, metabolism, cardiology, fibrosis, and neurology.
| Species | Application | Title |
|---|---|---|
Gastroenterology Dual inhibition of CDK4/6 and XPO1 induces senescence with acquired vulnerability to CRBN-based PROTAC drugs | ||
Acta Pharm Sin B Identification of USP2 as a novel target to induce degradation of KRAS in myeloma cells
| ||
Adv Sci (Weinh) PFKFB4 Deubiquitination by USP10 Enhances Fumarate Metabolism to Orchestrate the KDM1A/Rad51 Axis and Confer Radioresistance in Lung Cancer. | ||
Cell Death Dis Inhibition of USP2 eliminates cancer stem cells and enhances TNBC responsiveness to chemotherapy. | ||
Cancer Lett The deubiquitinase USP2a promotes tumor immunosuppression by stabilizing immune checkpoint B7-H4 in lung adenocarcinoma harboring EGFR-activating mutants | ||
J Immunother Cancer USP2-mediated PPARγ stabilization promotes hepatocellular carcinoma progression and M2 macrophage polarization via oleic acid.
|
Reviews
What customers say
The single review for this product is a 5-star rating. The user applied it in Western Blot and cell culture experiments using a 1:2000 dilution on eukaryotic samples, specifically to measure USP2 expression in human cancer cell lines. Overall, the feedback is positive, indicating the antibody performed well for its intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Karthik (Verified Customer) (04-22-2026) | We are going to measure the USP2 expression with human cancer cell lines.
|
