USP22 Monoclonal antibody

• 

  WB analysis using 60905-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60905-1-Ig (USP22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

USP22 Monoclonal Antibody for WB, ELISA

Cat No. 60905-1-Ig

Clone No.3D11H9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

Deubiquitinating enzyme 22, EC:3.4.19.12, KIAA1063, Ubiquitin carboxyl-terminal hydrolase 22, Ubiquitin thioesterase 22

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60905-1-Ig targets USP22 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34933

  Product name: Recombinant human USP22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 130-176 aa of NM_015276

  Sequence: MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR

• Full Name: ubiquitin specific peptidase 22
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: NM_015276
• Gene Symbol: USP22
• Gene ID (NCBI): 23326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UPT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP22, also named as KIAA1063 and USP3L, belongs to the peptidase C19 family and UBP8 subfamily. It is histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. USP22 catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. It is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. USP22 is required for nuclear receptor-mediated transactivation and cell cycle progression. USP22 has 2 isoforms with molecular mass of 58kDa and 60 kDa. The antibody is specific to USP22.