USP29 Polyclonal antibody

• 

  WB analysis using 27522-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27522-1-AP (USP29 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 27522-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 27522-1-AP (USP29 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 27522-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27522-1-AP (USP29 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 27522-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27522-1-AP (USP29 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

USP29 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27522-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Deubiquitinating enzyme 29, EC:3.4.19.12, HOM TES 84/86, Ubiquitin carboxyl-terminal hydrolase 29, Ubiquitin thioesterase 29

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

27522-1-AP targets USP29 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23231

  Product name: Recombinant human USP29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-285 aa of BC130394

  Sequence: MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQ

• Full Name: ubiquitin specific peptidase 29
• Observed Molecular Weight: 104 kDa
• GenBank Accession Number: BC130394
• Gene Symbol: USP29
• Gene ID (NCBI): 57663
• RRID: AB_2880898
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBJ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Oxid Med Cell Longev; Ubiquitin-Specific Protease 29 Exacerbates Cerebral Ischemia-Reperfusion Injury in Mice.; Authors - Jia-Bao Hou ; KO Validated
mouse	WB,IP	Redox Biol; ALDH2 deficiency augments atherosclerosis through the USP14-cGAS-dependent polarization of proinflammatory macrophages; Authors - Haiying Rui
mouse	IHC	Clin Mol Hepatol; USP29 alleviates the progression of MASLD by stabilizing ACSL5 through K48 deubiquitination; Authors - Sha Hu