USP30 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83240-5-RR (same clone as 83240-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83240-5-RR (USP30 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83240-5-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 83240-5-RR (same clone as 83240-5-PBS)

  WB result of USP30 antibody (83240-5-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP30 transfected HepG2 cells. This data was developed using the same antibody clone with 83240-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83240-5-RR (same clone as 83240-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug USP30 Recombinant antibody (83240-5-RR, Clone:240111C6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83240-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83240-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83240-5-RR against Human USP30 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

USP30 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83240-5-PBS

Clone No.240111C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

240111C6, Deubiquitinating enzyme 30, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 30, Ubiquitin thioesterase 30

---

Product Information

83240-5-PBS targets USP30 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7620

  Product name: Recombinant human USP30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 159-508 aa of BC004868

  Sequence: VITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE

• Full Name: ubiquitin specific peptidase 30
• Calculated Molecular Weight: 58.5 kDa
• Observed Molecular Weight: 59-67 kDa
• GenBank Accession Number: BC004868
• Gene Symbol: USP30
• Gene ID (NCBI): 84749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q70CQ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP30, a mitochondrion-localized deubiquitylase, regulates mitophagy. Mitochondrial damage stimulates parkin to assemble Lys 6, Lys 11 and Lys 63 chains on mitochondria, and that USP30 is a ubiquitin-specific deubiquitylase with a strong preference for cleaving Lys 6- and Lys 11-linked multimers. USP30 can be ubiquitinated by parkin (PARK2) at Lys-235 and Lys-289. USP30 inhibition is potentially beneficial for treating Parkinson disease by promoting mitochondrial clearance and quality control. USP30 was detected 67 kDa by ubiquitination (PMID: 34704599).