USP31 Polyclonal antibody

• 

  WB analysis using 32265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32265-1-AP (USP31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

USP31 Polyclonal Antibody for WB, ELISA

Cat No. 32265-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Ubiquitin thioesterase 31, KIAA1203, Deubiquitinating enzyme 31

---

Tested Applications

• Positive WB detected in: HaCaT cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32265-1-AP targets USP31 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36315

  Product name: Recombinant human USP31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1150-1352 aa of NM_020718

  Sequence: SDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGRGAGKHVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ

• Full Name: ubiquitin specific peptidase 31
• Calculated Molecular Weight: 146kDa
• Observed Molecular Weight: 147 kDa, 47 kDa
• GenBank Accession Number: NM_020718
• Gene Symbol: USP31
• Gene ID (NCBI): 57478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q70CQ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP31 (Ubiquitin Specific Peptidase 31) is a protein-coding gene that encodes a thiol-dependent deubiquitinating enzyme. It is involved in the process of protein deubiquitination, which is essential for regulating protein stability, function, and degradation. USP31 is broadly expressed in various tissues, including the testis and urinary bladder. It has 2 isoforms with the molecular mass of 47 and 147 kDa.