USP33 Polyclonal antibody

• 

  WB analysis of HEK-293 using 12060-2-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12060-2-AP (USP33 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human medulloblastoma using 12060-2-AP

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma using 12060-2-AP (USP33 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 12060-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12060-2-AP (USP33 antibody) at dilution of 1:50 (under 10x lens).

USP33 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12060-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Ubiquitin-specific-processing protease 33, Ubiquitin thioesterase 33, Ubiquitin carboxyl-terminal hydrolase 33, KIAA1097, hVDU1

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human medulloblastoma tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12060-2-AP targets USP33 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2695

  Product name: Recombinant human USP33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC016663

  Sequence: MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT

• Full Name: ubiquitin specific peptidase 33
• Calculated Molecular Weight: 942 aa, 107 kDa
• Observed Molecular Weight: 107 kDa/ 103 kDa/ 93 kDa
• GenBank Accession Number: BC016663
• Gene Symbol: USP33
• Gene ID (NCBI): 23032
• RRID: AB_2213235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing.