USP33 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP33 Polyclonal antibody (20445-1-AP)

• Featured Product
• KD/KO Validated

USP33 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20445-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:3.4.19.12, hVDU1, KIAA1097, Ubiquitin carboxyl-terminal hydrolase 33, Ubiquitin thioesterase 33

• 

  WB analysis using 20445-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 20445-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 20445-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 20445-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 20445-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20445-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20445-1-AP (USP33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 20445-1-AP

  IP result of anti-USP33 (IP:20445-1-AP, 4ug; Detection:20445-1-AP 1:300) with HEK-293 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20445-1-AP (USP33 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20445-1-AP (USP33 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 20445-1-AP (USP33 Antibody) at dilution of 1:50(under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 20445-1-AP (USP33 Antibody) at dilution of 1:50(under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 20445-1-AP (USP33 Antibody) at dilution of 1:50(under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20445-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 20445-1-AP (USP33 Antibody) at dilution of 1:50(under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 20445-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using 20445-1-AP (USP33 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP33 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human prostate cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20445-1-AP targets USP33 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14268

  Product name: Recombinant human USP33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-472 aa of BC016663

  Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR

• Full Name: ubiquitin specific peptidase 33
• Calculated Molecular Weight: 942 aa, 107 kDa
• Observed Molecular Weight: 103 kDa, 107 kDa
• GenBank Accession Number: BC016663
• Gene Symbol: USP33
• Gene ID (NCBI): 23032
• RRID: AB_10694439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing. This antibody is specific to USP33.

Publications

What published studies show

The anti-USP33 antibody (Cat# 20445-1-AP) has 26 citations published in journals including Nature Communications, Protein & Cell, Advanced Science, Cell Death & Disease, EMBO Reports, Journal of Cell Biology, Diabetes, FASEB Journal, and Oncotarget. Research fields span cancer biology (lung, breast, colorectal, pancreatic, glioblastoma), viral infections (SARS-CoV-2, HIV/SIV), ferroptosis, diabetic cardiomyopathy, neurotoxicity, immune regulation, and deubiquitination-mediated protein homeostasis.

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Protein Cell; USP33, a new player in lung cancer, mediates Slit-Robo signaling.; Authors - Pushuai Wen ; KD Validated
human	WB,IP	Nat Commun; USP9X regulates centrosome duplication and promotes breast carcinogenesis.; Authors - Xin Li
mouse	WB,IP	Adv Sci (Weinh); Lung-Targeted Lipid Nanoparticle-Delivered siUSP33 Attenuates SARS-CoV-2 Replication and Virulence by Promoting Envelope Degradation; Authors - Yuzheng Zhou
human	WB	Cell Death Dis; NudC-like protein 2 restrains centriole amplification by stabilizing HERC2.; Authors - Min Li ; KD Validated
human,mouse	WB,IP,IF	Cell Death Dis; USP33 alleviates FIS1-dependent mitochondrial fission and cardiac microvascular injury in diabetic cardiomyopathy via deubiquitinating and stabilizing ATG7.; Authors - Yuqiong Chen ; KD Validated
human	WB	Int J Biol Sci; USP33 Promotes Lung Adenocarcinoma Brain Metastasis by Inhibiting the K48-Linked Ubiquitination and Degradation of S100A9 and Facilitating Vimentin Secretion.; Authors - Zihao Wang