USP33 Recombinant monoclonal antibody, PBS Only (Capture)

USP33 Uni-rAb® Recombinant Antibody for IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84958-1-PBS
Clone No.242535A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

242535A6, EC:3.4.19.12, hVDU1, KIAA1097, Ubiquitin carboxyl-terminal hydrolase 33

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84958-1-PBS targets USP33 as part of a matched antibody pair:

MP01703-3: 84958-1-PBS capture and 84958-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14268

Product name: Recombinant human USP33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 290-472 aa of BC016663

Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR

Predict reactive species
Full Name ubiquitin specific peptidase 33
Calculated Molecular Weight 942 aa, 107 kDa
GenBank Accession NumberBC016663
Gene Symbol USP33
Gene ID (NCBI) 23032
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TEY7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

USP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...