USP33 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• USP33 Recombinant monoclonal antibody, PBS Only (Capture) (84958-1-PBS)

• 

  Sandwich ELISA standard curve of MP01703-3

  Sandwich ELISA standard curve of MP01703-3, Human USP33 Recombinant Matched Antibody Pair - PBS only. 84958-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag14268. 84958-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Sample test of MP01703-3

  The mean USP33 concentration was determined to be 8.27 ng/mL in HEK-293 cell extract based on a 2.7 mg/mL extract load, 4.70 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load and 3.49 ng/mL in A549 cell extract based on a 1.50 mg/mL extract load.

• 

  IF Staining of HeLa using 84958-1-RR (same clone as 84958-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using USP33 antibody (84958-1-RR, Clone: 242535A6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84958-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84958-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84958-1-RR against Human USP33 were performed. The affinity constant is below 1 pM.

USP33 Uni-rAb^® Recombinant Antibody for IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84958-1-PBS

Clone No.242535A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

242535A6, EC:3.4.19.12, hVDU1, KIAA1097, Ubiquitin carboxyl-terminal hydrolase 33

---

Product Information

84958-1-PBS targets USP33 as part of a matched antibody pair:

MP01703-3: 84958-1-PBS capture and 84958-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14268

  Product name: Recombinant human USP33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-472 aa of BC016663

  Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR

• Full Name: ubiquitin specific peptidase 33
• Calculated Molecular Weight: 942 aa, 107 kDa
• GenBank Accession Number: BC016663
• Gene Symbol: USP33
• Gene ID (NCBI): 23032
• RRID: AB_3743885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TEY7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing.