USP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• USP4 Polyclonal antibody, PBS Only (24976-1-PBS)

• 

  WB analysis of THP-1 using 24976-1-AP (same clone as 24976-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 24976-1-AP (USP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24976-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24976-1-AP (same clone as 24976-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24976-1-AP (USP4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24976-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 24976-1-AP (same clone as 24976-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 24976-1-AP (USP4 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24976-1-PBS in a different storage buffer formulation.

USP4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24976-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP, Unph

---

Product Information

24976-1-PBS targets USP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21684

  Product name: Recombinant human USP4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 567-779 aa of BC125131

  Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

• Full Name: ubiquitin specific peptidase 4 (proto-oncogene)
• Calculated Molecular Weight: 963 aa, 109 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC125131
• Gene Symbol: USP4
• Gene ID (NCBI): 7375
• RRID: AB_3085764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13107
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP4, also known as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).