USP47 Polyclonal antibody

• 

  WB analysis using 20376-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20376-1-AP (USP47 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 20376-1-AP

  IP result of anti-USP47 (IP:20376-1-AP, 4ug; Detection:20376-1-AP 1:800) with HeLa cells lysate 1400 ug.

USP47 Polyclonal Antibody for WB, IP, ELISA

Cat No. 20376-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

EC:3.4.19.12, TRFP, Ubiquitin carboxyl-terminal hydrolase 47, Ubiquitin-specific-processing protease 47, USP 47

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20376-1-AP targets USP47 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13990

  Product name: Recombinant human USP47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1219-1375 aa of BC000226

  Sequence: MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD

• Full Name: ubiquitin specific peptidase 47
• Calculated Molecular Weight: 1375 aa, 157 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: BC000226
• Gene Symbol: USP47
• Gene ID (NCBI): 55031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP47 (Ubiquitin-Specific Peptidase 47) is a deubiquitinating enzyme that regulates protein stability and function by specifically removing ubiquitin chains from target proteins. USP47 is involved in various fundamental biological processes, including DNA damage repair, cell cycle progression, Wnt signaling, and epithelial-mesenchymal transition. By deubiquitinating and stabilizing β-catenin and TLE3, this enzyme positively regulates the Wnt/β-catenin signaling pathway, thereby promoting cell proliferation and tumorigenesis. Studies have shown that USP47 is significantly overexpressed in various cancers, such as colorectal cancer, gastric cancer, and breast cancer, where it participates in epithelial-mesenchymal transition (EMT), DNA damage repair, and cell cycle regulation.