USP53 Recombinant monoclonal antibody, PBS Only (Capture)

USP53 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83846-1-PBS
Clone No.240971A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

240971A6, Inactive ubiquitin carboxyl-terminal hydrolase 53, Inactive ubiquitin-specific peptidase 53, KIAA1350

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83846-1-PBS targets USP53 as part of a matched antibody pair:

MP00821-1: 83846-1-PBS capture and 83846-2-PBS detection (validated in Cytometric bead array)

MP00821-2: 83846-1-PBS capture and 83846-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28923

Product name: Recombinant human USP53 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 371-600 aa of NM_019050

Sequence: YKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSHSHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQSGSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSES

Predict reactive species
Full Name ubiquitin specific peptidase 53
Calculated Molecular Weight 121 kDa
Observed Molecular Weight120-130 kDa
GenBank Accession NumberNM_019050
Gene Symbol USP53
Gene ID (NCBI) 54532
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ70EK8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitin specific peptidase 53 (USP53) was originally discovered in cholestasis, and its tumor suppressive effects have recently been reported in various cancers. Zhao et al. showed that USP53 interacted with FKBP51 in lung adenocarcinoma cells, and induced apoptosis via the AKT pathway. Furthermore, USP53 inhibited the progression of clear cell renal cell carcinoma by suppressing the nuclear factor κB (NF‐κB) pathway. (PMID: 35654790)

Loading...
||
New chat Able
正在加载,请稍候...